DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and Lin28a

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001102739.1 Gene:Lin28a / 500562 RGDID:1566408 Length:209 Species:Rattus norvegicus


Alignment Length:97 Identity:28/97 - (28%)
Similarity:40/97 - (41%) Gaps:24/97 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 GPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCT 91
            |||||     ...|..|...|..|::.|.|                 .:|||.|.|:.|.:|:|.
  Rat   111 GPGGV-----FCIGSERRPKGKSMQKRRSK-----------------GDRCYNCGGLDHHAKECK 153

  Fly    92 QADNP-TCYRCNKTGHWVRNCPEAVNERGPTN 122
            ....| .|:.|....|.|.:||... ::||::
  Rat   154 LPPQPKKCHFCQSISHMVASCPLKA-QQGPSS 184

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 28/97 (29%)