DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and zcchc9

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001011465.1 Gene:zcchc9 / 496956 XenbaseID:XB-GENE-972766 Length:246 Species:Xenopus tropicalis


Alignment Length:172 Identity:40/172 - (23%)
Similarity:60/172 - (34%) Gaps:58/172 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GNDGGGMRR--------NREKCYK-------CNQFGHFAR-----ACPEEAER------------ 76
            |..|.|.|:        |.:|..|       .|.||.:..     ..|.:.:|            
 Frog    36 GEGGAGKRKAPVPQPPPNNKKKKKDVYVNQDVNGFGQYQAELGGVESPRKEQRREDRRLKRQTHK 100

  Fly    77 -----CYRCNGIGHISKDCT------QADNPTCYRCNKTGHWVRNCPEAVNERGPT-----NVSC 125
                 |:.|...||...||.      ::....|:||..|.|.:..|...|:   |.     ...|
 Frog   101 KDRMICFHCRKPGHGMADCAEVLRCQESGTGICFRCGSTEHELTKCRAKVD---PALGEFPFAKC 162

  Fly   126 YKCNRTGHISKNCPETSK-------TCYGCGKSGHLRRECDE 160
            :.|...||:|::||:..|       :|..||...|.:|:|.:
 Frog   163 FICGEMGHLSRSCPDNPKGLYAEGGSCRICGSVEHFQRDCPQ 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 40/172 (23%)
zcchc9NP_001011465.1 PTZ00368 <106..203 CDD:173561 27/99 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.