DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and yps

DIOPT Version :10

Sequence 1:NP_611739.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_061503298.1 Gene:yps / 4576730 VectorBaseID:AGAMI1_014529 Length:400 Species:Anopheles gambiae


Alignment Length:56 Identity:23/56 - (41%)
Similarity:26/56 - (46%) Gaps:14/56 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GGGGGPGGVGGGG-----------GGGGGGMRGNDG---GGMRRNREKCYKCNQFG 64
            ||..|.||.||||           ||.||||.|..|   ||.|.:.:..|:.|..|
Mosquito   292 GGMRGQGGRGGGGPRRFFRRNYRSGGRGGGMGGPPGPRRGGYRPDYQADYQQNGGG 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_611739.1 PTZ00368 6..161 CDD:173561 23/56 (41%)
ypsXP_061503298.1 None

Return to query results.
Submit another query.