DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and cnbp

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_031755848.1 Gene:cnbp / 448166 XenbaseID:XB-GENE-919590 Length:177 Species:Xenopus tropicalis


Alignment Length:178 Identity:70/178 - (39%)
Similarity:93/178 - (52%) Gaps:32/178 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGG--------------MRGNDGGGMRRN- 53
            |..|:||.|.||:||:|..|||.|.||.|.|.||....              .|..:.|.:.:: 
 Frog     3 SNECFKCGRTGHWARECPTGGGRGRGGRGRGRGGFSSSRGFQFISSSLPDICYRCGESGHLAKDC 67

  Fly    54 ---REKCYKCNQFGHFARACPE---EAER-CYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNC 111
               .:.||.|.:.||.|:.|.|   |.|: ||.|...||:::||..||...||.|.:.||..::|
 Frog    68 DLQEDACYNCGRGGHIAKDCKEPRKEREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDC 132

  Fly   112 PEAVNERGPTNVSCYKCNRTGHISKNCPETSK-TCYGCGKSGHLRREC 158
                     |.|.||:|..|||::.||.:||: .||.||:||||.|||
 Frog   133 ---------TKVKCYRCGETGHVAINCSKTSEVNCYRCGESGHLAREC 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 69/176 (39%)
cnbpXP_031755848.1 PTZ00368 <6..89 CDD:173561 28/82 (34%)
PTZ00368 54..171 CDD:173561 48/125 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4500
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005222
OrthoInspector 1 1.000 - - oto105002
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X357
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.