DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and zcchc9

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_938184.1 Gene:zcchc9 / 386639 ZFINID:ZDB-GENE-031030-9 Length:256 Species:Danio rerio


Alignment Length:188 Identity:47/188 - (25%)
Similarity:64/188 - (34%) Gaps:63/188 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GGGGGGGGGMRGNDGGGMRRNREKCYK------CNQF--------------------GHFARACP 71
            |..|...||.....|.|:|:......|      .|.|                    |....|..
Zfish    31 GAAGTSRGGRNIQQGSGVRKKPNPKTKQHDNEDVNGFMEYLKQTGQTLQKHTPVDLRGEVETALK 95

  Fly    72 EEAER----------------CYRCNGIGHISKDCTQADNP------TCYRCNKTGHWVRNCPEA 114
            ::|.|                |:.|...||...||.:|:|.      .||||..|.|.::.|...
Zfish    96 KDARRENRRIKRQNTKKSNMICFNCRKPGHGLADCPEANNDEEMGRGICYRCGSTEHEIQRCRAK 160

  Fly   115 VNERGPT-----NVSCYKCNRTGHISKNCPETSKTCYG-------CGKSGHLRRECDE 160
            |:   |.     ...|:.|.:|||:||.||:..|..|.       ||...|.:::|.|
Zfish   161 VD---PAMGNYPYAKCFVCGQTGHLSKACPDNPKGLYAAGGCCRVCGSVEHFQKDCPE 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 47/188 (25%)
zcchc9NP_938184.1 PTZ00368 <117..215 CDD:173561 32/100 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.