powered by:
Protein Alignment CNBP and Zcchc14
DIOPT Version :9
Sequence 1: | NP_001188992.1 |
Gene: | CNBP / 37646 |
FlyBaseID: | FBgn0034802 |
Length: | 165 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_344781.5 |
Gene: | Zcchc14 / 365018 |
RGDID: | 1309494 |
Length: | 1087 |
Species: | Rattus norvegicus |
Alignment Length: | 39 |
Identity: | 18/39 - (46%) |
Similarity: | 19/39 - (48%) |
Gaps: | 5/39 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 SLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYK 59
||.||| ||||||||||.......|.......|:|
Rat 163 SLNGGG-----GGGGGGGGGGKSAPGPSGALPTCSACHK 196
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5082 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.