DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and cnbpb

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001313334.1 Gene:cnbpb / 335839 ZFINID:ZDB-GENE-030131-7782 Length:161 Species:Danio rerio


Alignment Length:172 Identity:61/172 - (35%)
Similarity:79/172 - (45%) Gaps:36/172 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFAR 68
            |..|:.|.|.||:.::|.          ..|.|.|.|..||.|        ..||:|.:.||.||
Zfish     3 SNECFGCGRTGHWIKNCP----------NAGRGRGKGRGRGKD--------LFCYRCGEPGHVAR 49

  Fly    69 ACPEEAERCYRCNGIGHISKDCTQAD---NPTCYRCNKTGHWVRNCPEAVNE------------- 117
            .|....:.||.|...||||:||.:..   ...||.|.|.||..|:|..| ||             
Zfish    50 DCERTEDACYNCGRGGHISRDCKEPKKEREQVCYNCGKAGHMARDCDHA-NEQKCYSCGGFGHIQ 113

  Fly   118 RGPTNVSCYKCNRTGHISKNCPETSK-TCYGCGKSGHLRREC 158
            :|...|.||:|...||::..|.:.|: .||.||||||:.:||
Zfish   114 KGCEKVKCYRCGEIGHVAVQCSKASEVNCYNCGKSGHVAKEC 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 60/170 (35%)
cnbpbNP_001313334.1 COG5222 <6..>20 CDD:227547 5/13 (38%)
PTZ00368 38..155 CDD:173561 45/117 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595686
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 115 1.000 Inparanoid score I4807
OMA 1 1.010 - - QHG53072
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 1 1.000 - - FOG0005222
OrthoInspector 1 1.000 - - otm24488
orthoMCL 1 0.900 - - OOG6_101988
Panther 1 1.100 - - O PTHR23002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4830
SonicParanoid 1 1.000 - - X357
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.