DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and zcchc7

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_009306003.1 Gene:zcchc7 / 317641 ZFINID:ZDB-GENE-030102-2 Length:638 Species:Danio rerio


Alignment Length:164 Identity:41/164 - (25%)
Similarity:61/164 - (37%) Gaps:43/164 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFAR 68
            |.||..||:.||.:::|.                            ..:....|..|...||..|
Zfish   284 SITCRNCNKTGHLSKNCP----------------------------TLKKVPCCSLCGLRGHLLR 320

  Fly    69 ACPEEAERCYRCNGIGHISKDCTQAD--NPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRT 131
            .||.  ..|..|:..||.|.||.:..  ...|:||..|||::..||:...:...|..:       
Zfish   321 TCPN--RHCSNCSLPGHTSDDCLERAFWYKRCHRCGMTGHFIDACPQIWRQYHLTTTA------- 376

  Fly   132 GHISKNC-PETSKT---CYGCGKSGHLRRECDEK 161
            |.|.|:. |:..:.   ||.|.:.||...:|.::
Zfish   377 GPIRKSADPKACQKRAYCYNCSRKGHFGHQCSQR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 40/160 (25%)
zcchc7XP_009306003.1 PTZ00368 265..407 CDD:173561 40/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.