DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and Zcchc13

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_003752133.1 Gene:Zcchc13 / 302399 RGDID:1589760 Length:170 Species:Rattus norvegicus


Alignment Length:177 Identity:61/177 - (34%)
Similarity:85/177 - (48%) Gaps:41/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRR--------NREKCYKCNQ 62
            :|:||.|.||:||:|.                 .||.||....|..|        ..:.||:|.:
  Rat     5 SCFKCGRSGHWARECP-----------------KGGTRGRTTRGRTRGPQCSSASQSDVCYRCGE 52

  Fly    63 FGHFARACPEEAERCYRCNGIGHISKDCTQAD---NPTCYRCNKTGHWVRNCPEAVN-------- 116
            .||:|:.|....:.||.|...|||:||||||.   ...||.|::.||..|:|.....        
  Rat    53 TGHYAKDCDLLQDTCYNCGRRGHIAKDCTQAKREREQCCYICSRPGHLARDCDRQEEQKCYTCGE 117

  Fly   117 ----ERGPTNVSCYKCNRTGHISKNCPETSK-TCYGCGKSGHLRREC 158
                ::..|.:.||:|...||::.||.:.|: :||.||:||||.|||
  Rat   118 FGHIQKDCTQIKCYRCGENGHMAVNCSKASEVSCYRCGESGHLAREC 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 61/177 (34%)
Zcchc13XP_003752133.1 PTZ00368 46..167 CDD:173561 46/119 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353554
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4520
OMA 1 1.010 - - QHG53072
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 1 1.000 - - FOG0005222
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101988
Panther 1 1.100 - - O PTHR23002
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X357
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.