DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and F40F12.9

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001255048.1 Gene:F40F12.9 / 259311 WormBaseID:WBGene00043995 Length:113 Species:Caenorhabditis elegans


Alignment Length:87 Identity:24/87 - (27%)
Similarity:39/87 - (44%) Gaps:6/87 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHISKN 137
            |...||.|:.:||:|:||.:.....|::|...||:.|.||..:.::....::......|...|  
 Worm    25 EQSICYNCHKLGHMSRDCPEEQPKACFKCGFRGHYYRECPSQIEKKFVFLIALLAVYNTTFAS-- 87

  Fly   138 CPETSKTCYGCGKSGHLRRECD 159
                :..|:...|...||..||
 Worm    88 ----NSVCHITRKPLMLRAPCD 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 24/87 (28%)
F40F12.9NP_001255048.1 ZnF_C2HC 29..44 CDD:197667 8/14 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.