DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and SPAC683.02c

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_594481.1 Gene:SPAC683.02c / 2543491 PomBaseID:SPAC683.02c Length:218 Species:Schizosaccharomyces pombe


Alignment Length:130 Identity:35/130 - (26%)
Similarity:60/130 - (46%) Gaps:15/130 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MRGNDGGGMRRNREKCYKCNQFGHFARACPEEAER-CYRCNGIGHISKDCTQA-DNPT-CYRCNK 103
            |:.:.|...|.:..:..|.:::....|......:: |:.|...|||.:||.:| ||.: |:||..
pombe    43 MKASFGSSKRYDERQKKKRSEYRRLRRINQRNRDKFCFACRQQGHIVQDCPEAKDNVSICFRCGS 107

  Fly   104 TGHWVRNCPEAVNERGPTN-VSCYKCNRTGHISKNCPETSK-------TCYGCGKSGHLRRECDE 160
            ..|.:..|    :::||.. ..|:.|:..||:|..|.:..|       .|..|....||.::||:
pombe   108 KEHSLNAC----SKKGPLKFAKCFICHENGHLSGQCEQNPKGLYPKGGCCKFCSSVHHLAKDCDQ 168

  Fly   161  160
            pombe   169  168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 35/130 (27%)
SPAC683.02cNP_594481.1 AIR1 5..204 CDD:227414 35/130 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.