DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and air1

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_595383.2 Gene:air1 / 2541349 PomBaseID:SPBP35G2.08c Length:315 Species:Schizosaccharomyces pombe


Alignment Length:130 Identity:36/130 - (27%)
Similarity:43/130 - (33%) Gaps:38/130 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 GHFARACPEEAERCYRCNGIGHISKDCTQADNPT-----------------CYRCNKTGHWVRNC 111
            |.:..:.|.|:..|:.|.|.|||||||......|                 |..|...||....|
pombe    78 GRYFGSDPSESIVCHNCKGNGHISKDCPHVLCTTCGAIDDHISVRCPWTKKCMNCGLLGHIAARC 142

  Fly   112 PEAVNERGPTNVSCYKCNRTGHISKNCP------------------ETSKTCYGCGKSGHLRREC 158
            .|. .:|||.  .|..|:...|.|..||                  |..|.||.|....|...:|
pombe   143 SEP-RKRGPR--VCRTCHTDTHTSSTCPLIWRYYVEKEHPVRIDVSEVRKFCYNCASDEHFGDDC 204

  Fly   159  158
            pombe   205  204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 36/130 (28%)
air1NP_595383.2 AIR1 10..234 CDD:227414 36/130 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.