DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and lin-28

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_001021085.1 Gene:lin-28 / 172626 WormBaseID:WBGene00003014 Length:227 Species:Caenorhabditis elegans


Alignment Length:134 Identity:32/134 - (23%)
Similarity:50/134 - (37%) Gaps:21/134 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RPGHFARDCSLGGGGGPGGVGGGGGGGG-GGMRGNDGGGMRRNREKCYKCNQFG-HFARACPEEA 74
            |..::.::.|.|.|.....|.|...|.| .|.|.:..|..:....:|::|.:|. |.|::||.  
 Worm    98 RVSYYIQERSNGKGREAYAVSGEVEGQGLKGSRIHPLGRKKAVSLRCFRCGKFATHKAKSCPN-- 160

  Fly    75 ERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHIS-KNC 138
                            .:.|...||.|....|....|||...:..|..|:..:.......: |:.
 Worm   161 ----------------VKTDAKVCYTCGSEEHVSSICPERRRKHRPEQVAAEEAEAARMAAEKSS 209

  Fly   139 PETS 142
            |.||
 Worm   210 PTTS 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 32/134 (24%)
lin-28NP_001021085.1 CSD 55..119 CDD:278729 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.