DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and glh-1

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_491963.1 Gene:glh-1 / 172414 WormBaseID:WBGene00001598 Length:763 Species:Caenorhabditis elegans


Alignment Length:174 Identity:61/174 - (35%)
Similarity:75/174 - (43%) Gaps:36/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GHFARDCSLGGGGGPG----GVGGGGGGGGGGM----RGNDGGGMRRNREKCYKCNQFGHFARAC 70
            |...:..:.||.||.|    |.|.|||..|||.    .|..|||.|.|  .|:.|.|.||.:..|
 Worm   111 GSGEKSSAFGGSGGFGGSATGFGSGGGSFGGGNSGFGEGGHGGGERNN--NCFNCQQPGHRSSDC 173

  Fly    71 PE-----EAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVN-------------- 116
            ||     |...||.|...||.|::||:...|   |..:||.:........|              
 Worm   174 PEPRKEREPRVCYNCQQPGHTSRECTEERKP---REGRTGGFGGGAGFGNNGGNDGFGGDGGFGG 235

  Fly   117 --ERGPTNVSCYKCNRTGHISKNCPETSKTCYGCGKSGHLRREC 158
              ||||  :.|:.|...||.|..|||..:.|:.||:.||...||
 Worm   236 GEERGP--MKCFNCKGEGHRSAECPEPPRGCFNCGEQGHRSNEC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 61/174 (35%)
glh-1NP_491963.1 zf-CCHC 158..175 CDD:278525 7/18 (39%)
zf-CCHC 183..200 CDD:278525 7/16 (44%)
ZnF_C2HC 243..259 CDD:197667 6/15 (40%)
zf-CCHC 262..279 CDD:278525 7/16 (44%)
DEADc 343..558 CDD:238167
DEXDc 359..561 CDD:214692
Helicase_C 579..701 CDD:278689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1052
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D623350at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.