DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and cey-2

DIOPT Version :10

Sequence 1:NP_611739.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:NP_491645.1 Gene:cey-2 / 172219 WormBaseID:WBGene00000473 Length:267 Species:Caenorhabditis elegans


Alignment Length:48 Identity:13/48 - (27%)
Similarity:19/48 - (39%) Gaps:12/48 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 RNCPEAVNERGPTN------------VSCYKCNRTGHISKNCPETSKT 144
            :|.|||.|..||..            :|.::.||....|.:..|:..|
 Worm   125 KNGPEAANVTGPNGDNVIGSRYRHKLLSRFRKNRKPRASVDGEESQST 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_611739.1 PTZ00368 6..161 CDD:173561 13/48 (27%)
cey-2NP_491645.1 CSD 66..136 CDD:278729 5/10 (50%)

Return to query results.
Submit another query.