powered by:
Protein Alignment CNBP and cey-3
DIOPT Version :9
Sequence 1: | NP_001188992.1 |
Gene: | CNBP / 37646 |
FlyBaseID: | FBgn0034802 |
Length: | 165 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001367859.1 |
Gene: | cey-3 / 172211 |
WormBaseID: | WBGene00000474 |
Length: | 265 |
Species: | Caenorhabditis elegans |
Alignment Length: | 33 |
Identity: | 12/33 - (36%) |
Similarity: | 14/33 - (42%) |
Gaps: | 4/33 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 RNCPEAVNERGPTNV----SCYKCNRTGHISKN 137
:|.|||.|..||..| |.|:........||
Worm 123 KNGPEAANVTGPAGVNVSGSKYRHQLLSRFRKN 155
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CNBP | NP_001188992.1 |
PTZ00368 |
6..161 |
CDD:173561 |
12/33 (36%) |
cey-3 | NP_001367859.1 |
CSD |
64..134 |
CDD:278729 |
5/10 (50%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.