DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and Zcchc14

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_006530730.1 Gene:Zcchc14 / 142682 MGIID:2159407 Length:1081 Species:Mus musculus


Alignment Length:143 Identity:33/143 - (23%)
Similarity:38/143 - (26%) Gaps:59/143 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGIGH 85
            ||..|||    |||||||||.......|.:                                   
Mouse   163 SLNSGGG----GGGGGGGGGKSAPGPSGAL----------------------------------- 188

  Fly    86 ISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHISKNCPETSKTCYGCGK 150
                      |||..|:|.         |.....|.:..........|.|.:..|.|......||
Mouse   189 ----------PTCSACHKM---------APRTETPVSSISNSLENALHTSAHSTEESLPKRPLGK 234

  Fly   151 SGHLRRE-CDEKG 162
            .|.:..| .|.||
Mouse   235 HGKVSVEKIDLKG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 31/140 (22%)
Zcchc14XP_006530730.1 PX_domain 261..342 CDD:383026
SAM_ZCCH14 437..501 CDD:188957
DUF5585 689..>863 CDD:375359
zf-CCHC 1052..1067 CDD:365871
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.