DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and LOC101732984

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_031747401.1 Gene:LOC101732984 / 101732984 -ID:- Length:822 Species:Xenopus tropicalis


Alignment Length:143 Identity:31/143 - (21%)
Similarity:47/143 - (32%) Gaps:45/143 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GGGMRRNREKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGH----- 106
            |..:|::.|:. |....||||    ||:.|....:.:.|:.|.  :..|...:|...:||     
 Frog   293 GWDVRKDLEET-KEGLKGHFA----EESRRIIFRSKVEHLEKG--EKCNSFFFRKLHSGHTPLTE 350

  Fly   107 ---------------WVRNCPE--AVNERGP-------------TNVSCYKCNRTGHISKNCPET 141
                           .:|..||  .:...||             ..|.|........:.:.|.:.
 Frog   351 LRDETGTLKSELFAECIRRNPEIRGITAPGPARSQIKCSLYMDDVTVFCADQQSVRSLVQTCEDF 415

  Fly   142 SKTC---YGCGKS 151
            ||..   ..||||
 Frog   416 SKASGAKVNCGKS 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 31/143 (22%)
LOC101732984XP_031747401.1 L1-EN 1..198 CDD:197310
RT_like <362..459 CDD:413489 14/67 (21%)
zf-RVT <663..731 CDD:404792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.