powered by:
Protein Alignment CNBP and LOC101730707
DIOPT Version :9
Sequence 1: | NP_001188992.1 |
Gene: | CNBP / 37646 |
FlyBaseID: | FBgn0034802 |
Length: | 165 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_004915563.1 |
Gene: | LOC101730707 / 101730707 |
-ID: | - |
Length: | 599 |
Species: | Xenopus tropicalis |
Alignment Length: | 109 |
Identity: | 29/109 - (26%) |
Similarity: | 44/109 - (40%) |
Gaps: | 28/109 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 55 EKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERG 119
:.|:||....|.:.:| ...:|.||:..||.:|.| :|..|..|:..||....||:|.:..|
Frog 494 KNCFKCGSDEHPSISC--LVTKCSRCHTTGHATKTC---NNIRCNLCSLLGHTYSRCPQAWHNTG 553
Fly 120 PT---------------------NVSCYKCNRTGHISKNCPETS 142
.| .||| ..:..|::|.|.:.|
Frog 554 ATCVTPQQETNKQPTIIQGDRVAAVSC--AQQQSHVAKECLQFS 595
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CNBP | NP_001188992.1 |
PTZ00368 |
6..161 |
CDD:173561 |
29/109 (27%) |
LOC101730707 | XP_004915563.1 |
Spc7 |
<24..139 |
CDD:285512 |
|
AIR1 |
<496..>549 |
CDD:227414 |
19/57 (33%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1535084at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.