DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and LOC101730707

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_004915563.1 Gene:LOC101730707 / 101730707 -ID:- Length:599 Species:Xenopus tropicalis


Alignment Length:109 Identity:29/109 - (26%)
Similarity:44/109 - (40%) Gaps:28/109 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 EKCYKCNQFGHFARACPEEAERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNCPEAVNERG 119
            :.|:||....|.:.:|  ...:|.||:..||.:|.|   :|..|..|:..||....||:|.:..|
 Frog   494 KNCFKCGSDEHPSISC--LVTKCSRCHTTGHATKTC---NNIRCNLCSLLGHTYSRCPQAWHNTG 553

  Fly   120 PT---------------------NVSCYKCNRTGHISKNCPETS 142
            .|                     .|||  ..:..|::|.|.:.|
 Frog   554 ATCVTPQQETNKQPTIIQGDRVAAVSC--AQQQSHVAKECLQFS 595

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 29/109 (27%)
LOC101730707XP_004915563.1 Spc7 <24..139 CDD:285512
AIR1 <496..>549 CDD:227414 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.