DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and zcchc7

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_002935926.2 Gene:zcchc7 / 100494657 XenbaseID:XB-GENE-6258335 Length:562 Species:Xenopus tropicalis


Alignment Length:161 Identity:42/161 - (26%)
Similarity:61/161 - (37%) Gaps:43/161 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACP 71
            |..|::.||.:::|.                            :.:....|..|.:.||...:||
 Frog   265 CRNCDKRGHLSKNCP----------------------------VPKKLPACCLCGERGHLQNSCP 301

  Fly    72 EEAERCYRCNGIGHISKDCTQAD--NPTCYRCNKTGHWVRNCPEAVNERGPTNVSCYKCNRTGHI 134
              |..|..|...||..|:|.:..  ..||:||:.|||:...|||...:...|       |:.|.|
 Frog   302 --ARYCLNCFLPGHFFKECIERAYWRKTCHRCSMTGHYADACPEIWRQYHLT-------NKAGPI 357

  Fly   135 SKNCPETSKT----CYGCGKSGHLRRECDEK 161
            .|....|.:.    |..|.|.||...||:|:
 Frog   358 KKPKSYTGQKDIVYCCNCAKKGHCNYECEER 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 41/159 (26%)
zcchc7XP_002935926.2 AIR1 <258..389 CDD:227414 42/161 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.