powered by:
Protein Alignment CNBP and LOC100488592
DIOPT Version :9
Sequence 1: | NP_001188992.1 |
Gene: | CNBP / 37646 |
FlyBaseID: | FBgn0034802 |
Length: | 165 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_002943397.2 |
Gene: | LOC100488592 / 100488592 |
-ID: | - |
Length: | 437 |
Species: | Xenopus tropicalis |
Alignment Length: | 53 |
Identity: | 16/53 - (30%) |
Similarity: | 18/53 - (33%) |
Gaps: | 16/53 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 CYKCNQFGHFARACPEEAERC--------------YRCN--GIGHISKDCTQA 93
||.|....|||..||.|.:|. |... |.|..:..|.||
Frog 380 CYVCASTEHFASDCPIEKQRMIDEYNLSRMEDYDDYEAQYYGYGTETASCRQA 432
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CNBP | NP_001188992.1 |
PTZ00368 |
6..161 |
CDD:173561 |
16/53 (30%) |
LOC100488592 | XP_002943397.2 |
PHA00430 |
<40..>140 |
CDD:222790 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1535084at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.