powered by:
Protein Alignment CNBP and LOC100488231
DIOPT Version :9
Sequence 1: | NP_001188992.1 |
Gene: | CNBP / 37646 |
FlyBaseID: | FBgn0034802 |
Length: | 165 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012809937.2 |
Gene: | LOC100488231 / 100488231 |
-ID: | - |
Length: | 362 |
Species: | Xenopus tropicalis |
Alignment Length: | 68 |
Identity: | 21/68 - (30%) |
Similarity: | 30/68 - (44%) |
Gaps: | 17/68 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 ERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNC--PEAVNERGPTNVSCYKCNRTGHISKN 137
|.|.||...||::..|.: |..|.|.||.|::| |: .|..|.:.||:...
Frog 179 EFCKRCRLYGHVTDGCVR-----CQNCGKDGHEVKSCSVPK----------KCNFCLQEGHLYAG 228
Fly 138 CPE 140
||:
Frog 229 CPQ 231
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CNBP | NP_001188992.1 |
PTZ00368 |
6..161 |
CDD:173561 |
21/68 (31%) |
LOC100488231 | XP_012809937.2 |
AIR1 |
<180..>233 |
CDD:227414 |
20/67 (30%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1535084at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.