DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CNBP and LOC100488231

DIOPT Version :9

Sequence 1:NP_001188992.1 Gene:CNBP / 37646 FlyBaseID:FBgn0034802 Length:165 Species:Drosophila melanogaster
Sequence 2:XP_012809937.2 Gene:LOC100488231 / 100488231 -ID:- Length:362 Species:Xenopus tropicalis


Alignment Length:68 Identity:21/68 - (30%)
Similarity:30/68 - (44%) Gaps:17/68 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 ERCYRCNGIGHISKDCTQADNPTCYRCNKTGHWVRNC--PEAVNERGPTNVSCYKCNRTGHISKN 137
            |.|.||...||::..|.:     |..|.|.||.|::|  |:          .|..|.:.||:...
 Frog   179 EFCKRCRLYGHVTDGCVR-----CQNCGKDGHEVKSCSVPK----------KCNFCLQEGHLYAG 228

  Fly   138 CPE 140
            ||:
 Frog   229 CPQ 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CNBPNP_001188992.1 PTZ00368 6..161 CDD:173561 21/68 (31%)
LOC100488231XP_012809937.2 AIR1 <180..>233 CDD:227414 20/67 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1535084at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.