DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and REEP6

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001316485.1 Gene:REEP6 / 92840 HGNCID:30078 Length:211 Species:Homo sapiens


Alignment Length:220 Identity:57/220 - (25%)
Similarity:90/220 - (40%) Gaps:66/220 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 FNTACICSLIVIFLAPRTCAQSLLFPAFRLFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAF 194
            :..:.:|:||                      |.:||||||.||:.:....:...|:.||:|:|.
Human    52 YGASLLCNLI----------------------GFVYPAYASIKAIESPSKDDDTVWLTYWVVYAL 94

  Fly   195 FTCIETFTDIFISWLPFYYEVKVALVFWLLSPAT-KGSSTLYRKFVHPMLTRHEQEIDEYVNQAK 258
            |...|.|:|:.:||.||||..|.|.:.:.::|.. .|:..||::.|.|:..||...:|..:|...
Human    95 FGLAEFFSDLLLSWFPFYYVGKCAFLLFCMAPRPWNGALMLYQRVVRPLFLRHHGAVDRIMNDLS 159

  Fly   259 ERGYSAVLQLGSKGVNYATNVLMQTAIKGGGNLVQTIKRSYSLSDLSEPDMHRTQDELDDVMMSS 323
            .|...|     :.|:.              .|::|.:.||                      .:.
Human   160 GRALDA-----AAGIT--------------RNVLQVLARS----------------------RAG 183

  Fly   324 MTSSAVVMRSTATGARLLRPRNQTP 348
            :|..||...||...|. |:| :|||
Human   184 ITPVAVAGPSTPLEAD-LKP-SQTP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 31/83 (37%)
REEP6NP_001316485.1 TB2_DP1_HVA22 66..143 CDD:308643 29/76 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 190..211 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.