DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and HVA22A

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001323240.1 Gene:HVA22A / 843793 AraportID:AT1G74520 Length:177 Species:Arabidopsis thaliana


Alignment Length:134 Identity:34/134 - (25%)
Similarity:63/134 - (47%) Gaps:23/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIE-TFTDIFISWLPFYYEVKVALVFWLLSPA 227
            :||.|||.:|:.|:...:..:|:.||::::..|.|| ||..: |.|||.:..:|:.|..||:.|.
plant    27 VYPLYASVQAIETQSHADDKQWLTYWVLYSLLTLIELTFAKL-IEWLPIWSYMKLILTCWLVIPY 90

  Fly   228 TKGSSTLYRKFVHPM-----------------LTRHEQEI----DEYVNQAKERGYSAVLQLGSK 271
            ..|::.:|..||.|:                 :.|...::    ::|:.:.....:..:|....|
plant    91 FSGAAYVYEHFVRPVFVNPRSINIWYVPKKMDIFRKPDDVLTAAEKYIAENGPDAFEKILSRADK 155

  Fly   272 GVNY 275
            ...|
plant   156 SKRY 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 28/77 (36%)
HVA22ANP_001323240.1 TB2_DP1_HVA22 29..104 CDD:397309 27/75 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.