DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and HVA22H

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_564100.1 Gene:HVA22H / 838584 AraportID:AT1G19950 Length:315 Species:Arabidopsis thaliana


Alignment Length:312 Identity:67/312 - (21%)
Similarity:117/312 - (37%) Gaps:73/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 GTLYPAYASYKAVRTK--DVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYYEVKVALVFWLL 224
            |..||||..||||...  ::::...|..|||:.|..|..|...|...||:|.|.|.|:|...:|.
plant    15 GYAYPAYECYKAVEKNKPEMQQLRFWCQYWILVAALTIFERVGDALASWVPLYCEAKLAFFIYLW 79

  Fly   225 SPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKGGG 289
            .|.|:|::.:|..|..|.:.:||.|||.           ::::|.:|..:.|. :..:.|:..|.
plant    80 FPKTRGTTYVYDSFFQPYVAKHENEIDR-----------SLIELRTKAGDLAV-IYCRKAVSYGQ 132

  Fly   290 NLVQTIKRSYSLSDLSEPD---------MHRTQDELDDVMMSSMTSSA------------VVMRS 333
            ..:..|....:|....:|.         ....:.:..|:..:|..:|:            :|.:.
plant   133 TRIVEILHFVALQSTPKPKPKEKKQAAAPEEEEQKQPDLKATSQAASSNPQVRLQSKKPQLVTKE 197

  Fly   334 TATGARLLRPRNQTPVGRSGSGTRHSTGMYFTEVDVTA----------------------KNAGD 376
            ..:...|..||.|..:.......:.|.    ::..:|.                      :||..
plant   198 PISPKPLSSPRKQQQLQTETKEAKASV----SQTKLTTLTPPGPPPPPPPPPPSPTTAAKRNADP 258

  Fly   377 FNYNIRSQDDISSGYSS-AEPVSGLSRTSS-----------MTNASKARAKS 416
            ...:....::.|...:: .||.|.:.|.||           :|..|..:|:|
plant   259 AQPSPTEAEEASQTVAALPEPASEIQRASSSKETIMEETLRITRGSLRKARS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 30/80 (38%)
HVA22HNP_564100.1 TB2_DP1_HVA22 7..96 CDD:281172 30/80 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I2065
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - mtm984
orthoMCL 1 0.900 - - OOG6_102704
Panther 1 1.100 - - O PTHR12300
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.