DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and HVA22B

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_201055.1 Gene:HVA22B / 836369 AraportID:AT5G62490 Length:167 Species:Arabidopsis thaliana


Alignment Length:96 Identity:27/96 - (28%)
Similarity:48/96 - (50%) Gaps:4/96 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LLFPAFRLFCG----TLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFY 212
            ::|..|.:..|    .:||.|||.:|:.::...:..:|:.||.:::.....|......:.|:|.|
plant    11 VIFKNFDVIAGPVISLVYPLYASVRAIESRSHGDDKQWLTYWALYSLIKLFELTFFRLLEWIPLY 75

  Fly   213 YEVKVALVFWLLSPATKGSSTLYRKFVHPML 243
            ...|:||..||:.|...|::.||..:|...|
plant    76 PYAKLALTSWLVLPGMNGAAYLYEHYVRSFL 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 24/86 (28%)
HVA22BNP_201055.1 TB2_DP1_HVA22 29..105 CDD:397309 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.