DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and HVA22E

DIOPT Version :10

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_568744.1 Gene:HVA22E / 835144 AraportID:AT5G50720 Length:116 Species:Arabidopsis thaliana


Alignment Length:96 Identity:30/96 - (31%)
Similarity:49/96 - (51%) Gaps:4/96 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SLLFPAFRLFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYYEV 215
            ||..|...|    |||.|||..|:.:....:..:|:.|||:::|.|..|......:.|:|.:|..
plant    13 SLAGPVVML----LYPLYASVIAIESPSKVDDEQWLAYWILYSFLTLSELILQSLLEWIPIWYTA 73

  Fly   216 KVALVFWLLSPATKGSSTLYRKFVHPMLTRH 246
            |:..|.||:.|..:|::.:|.|.|.....::
plant    74 KLVFVAWLVLPQFRGAAFIYNKVVREQFKKY 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 166..242 CDD:460820 24/75 (32%)
HVA22ENP_568744.1 TB2_DP1_HVA22 24..98 CDD:460820 23/73 (32%)

Return to query results.
Submit another query.