DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and AT5G42560

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_568606.1 Gene:AT5G42560 / 834262 AraportID:AT5G42560 Length:296 Species:Arabidopsis thaliana


Alignment Length:347 Identity:82/347 - (23%)
Similarity:134/347 - (38%) Gaps:78/347 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 SLLFPAFRLFCGTLYPAYASYKAVRTK--DVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYY 213
            |.|.....:..|..||||..||.|...  ::::...|..|||:.|..|..|...|.|:||:|.|.
plant     4 SFLTRGLVMVLGYAYPAYECYKTVEKNRPEIEQLRFWCQYWILVACLTVFERVGDAFVSWVPMYS 68

  Fly   214 EVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQAKER-GYSAVL---QLGSKGVN 274
            |.|:|...:|..|.|:|::.:|..|..|.|::||.:||..:.:.:.| |..||:   ::.|.|..
plant    69 EAKLAFFIYLWYPKTRGTTYVYESFFRPYLSQHENDIDHSLLELRTRAGDMAVIYWQRVASYGQT 133

  Fly   275 YATNVLMQTAI----------KGGGNLVQT-IKRSYSLSDLSEPDMHRTQDELDDVMMSSMTSSA 328
            ....:|...|.          |.||...|. .|...:....|||         ::|.:||.:||:
plant   134 RILEILQYVAAQSTPRPQPPQKRGGRANQAPAKPKKAPVPQSEP---------EEVSLSSSSSSS 189

  Fly   329 VVMRSTATGARLLRPRNQTPVGRSGSGTRHSTGMYFTEVDVTA------KNAGDFNYNIRSQDDI 387
                              :........||..:|.......||:      ||||....   :|..:
plant   190 ------------------SSENEGNEPTRKVSGPSRPRPTVTSVPAADPKNAGTTQI---AQKSV 233

  Fly   388 SSGYSSAEPVSGLSRTSSMTNASKARAKSKRNELLEEMRDEVYLDNQLYFQGVQRKSSVPEAEEL 452
            :|      |:....::::.....:          :||:..|....|:         :..||..:.
plant   234 AS------PIVNPPQSTTQVEPMQ----------IEEVEGEAESGNE---------NPNPEGPKE 273

  Fly   453 KIVESSESIQSQELEKVLKEEN 474
            .::|.:..:....|.|...||:
plant   274 TVMEETIRMTRGRLRKTRSEES 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 30/84 (36%)
AT5G42560NP_568606.1 TB2_DP1_HVA22 19..97 CDD:397309 28/77 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I2065
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - mtm984
orthoMCL 1 0.900 - - OOG6_102704
Panther 1 1.100 - - LDO PTHR12300
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.