DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and REEP4

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_079508.2 Gene:REEP4 / 80346 HGNCID:26176 Length:257 Species:Homo sapiens


Alignment Length:337 Identity:121/337 - (35%)
Similarity:159/337 - (47%) Gaps:97/337 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 ICSLIVIFLAPRTCAQSLLFPAFRLFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIE 199
            ||.|:|           |:|       |.|.|||||||||:||:::|||:|||||||||.|...|
Human     6 ICRLVV-----------LVF-------GMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAE 52

  Fly   200 TFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQAKERGYSA 264
            ..|||||||.|||||:|:|.|.|||||.|||:|.||||||||.|:|||:|||.|:.|||||.|..
Human    53 IVTDIFISWFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYET 117

  Fly   265 VLQLGSKGVNYATNVLMQTAIKGGGNLVQTIKRSYSLSDLSE------PDMHRTQDELDDVMMSS 323
            ||..|.:|:|.|.:..:|.|.|..|.|...: ||:|:.||..      |..|      |.:.:..
Human   118 VLSFGKRGLNIAASAAVQAATKSQGALAGRL-RSFSMQDLRSISDAPAPAYH------DPLYLED 175

  Fly   324 MTSSAVVMRSTATGARLLRPRNQTPVGRSGSGTRHSTGMYFTEVDVTAKNAGDFNYNIRSQDDIS 388
            ..|..             ||    |:|....|.:.|.                      ::|:. 
Human   176 QVSHR-------------RP----PIGYRAGGLQDSD----------------------TEDEC- 200

  Fly   389 SGYSSAEPVSGLSRTSSMTNASKARAKSKRNELLEEMRDEVYLDNQLYFQGVQRKSSVPE--AEE 451
              :|..|.|            .:|.|:.:...|:......|          |:||..|.|  :..
Human   201 --WSDTEAV------------PRAPARPREKPLIRSQSLRV----------VKRKPPVREGTSRS 241

  Fly   452 LKIVESSESIQS 463
            ||:....:::.|
Human   242 LKVRTRKKTVPS 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 57/82 (70%)
REEP4NP_079508.2 TB2_DP1_HVA22 19..94 CDD:308643 55/74 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 183..257 20/118 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4920
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - otm40322
orthoMCL 1 0.900 - - OOG6_102704
Panther 1 1.100 - - LDO PTHR12300
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2950
SonicParanoid 1 1.000 - - X586
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.