DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and Reep4

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:XP_006519661.1 Gene:Reep4 / 72549 MGIID:1919799 Length:293 Species:Mus musculus


Alignment Length:267 Identity:108/267 - (40%)
Similarity:133/267 - (49%) Gaps:84/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 ICSLIVIFLAPRTCAQSLLFPAFRLFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIE 199
            ||.|:|           |:|       |.|||||||||||::|:::|||:|||||||||.|...|
Mouse     6 ICRLVV-----------LIF-------GMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAE 52

  Fly   200 TFTDIFISW------------------------------------LPFYYEVKVALVFWLLSPAT 228
            |||||||||                                    .|||||.|:|.|.|||||.|
Mouse    53 TFTDIFISWSGPRIGRPWGWEGPHHHHHHHLASGSHKPLPLLTHRFPFYYEFKMAFVLWLLSPYT 117

  Fly   229 KGSSTLYRKFVHPMLTRHEQEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKGGGNLVQ 293
            ||:|.||||||||.|:|||:|||..:.|||||.|..:|..|.:.:|.|.:..:|.|.|..|.|..
Mouse   118 KGASLLYRKFVHPSLSRHEKEIDACIVQAKERSYETMLSFGKRSLNIAASAAVQAATKSQGALAG 182

  Fly   294 TIKRSYSLSDL-SEPD--MHRTQDEL---DDVMMSSMTSSAVVMRSTATGARLLRPRNQTPVGRS 352
            .: ||:|:.|| |.||  :...||.|   |.|                       ||.:.|:|..
Mouse   183 RL-RSFSMQDLRSIPDTPVPTYQDPLYLEDQV-----------------------PRRRPPIGYR 223

  Fly   353 GSGTRHS 359
            ..|.:.|
Mouse   224 PGGLQGS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 59/118 (50%)
Reep4XP_006519661.1 TB2_DP1_HVA22 19..130 CDD:367349 56/110 (51%)
PRK11675 <247..>279 CDD:183272
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 137 1.000 Domainoid score I4856
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - otm42387
orthoMCL 1 0.900 - - OOG6_102704
Panther 1 1.100 - - LDO PTHR12300
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2950
SonicParanoid 1 1.000 - - X586
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.