DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and REEP1

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001358208.1 Gene:REEP1 / 65055 HGNCID:25786 Length:284 Species:Homo sapiens


Alignment Length:202 Identity:98/202 - (48%)
Similarity:123/202 - (60%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYYEVKVALVFWL 223
            |..|||||||.|||||::||:|||||||||||:||.||..|||||||:.|.|||||:|:|.|.||
Human    12 LIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVAWL 76

  Fly   224 LSPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKGG 288
            |||.|||||.||||||||.|:..|:|||:.:.|||:|.|.|::..|.:|:|.|....:..|.||.
Human    77 LSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQ 141

  Fly   289 GNLVQTIKRSYSLSDLS--------------------------EPDMHRTQDELDDVMMSSMTSS 327
            |.|.:.: ||:|:.||:                          :|.|.|:..|       |.:||
Human   142 GALSERL-RSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASE-------SASSS 198

  Fly   328 AVVMRST 334
            .....||
Human   199 VCTCCST 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 62/81 (77%)
REEP1NP_001358208.1 TB2_DP1_HVA22 19..94 CDD:367349 57/74 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4920
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - otm40322
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2950
SonicParanoid 1 1.000 - - X586
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.