DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and zgc:101744

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001013554.2 Gene:zgc:101744 / 541409 ZFINID:ZDB-GENE-050320-111 Length:184 Species:Danio rerio


Alignment Length:145 Identity:43/145 - (29%)
Similarity:71/145 - (48%) Gaps:23/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 FNTACICSLIVIFLAPRTCAQSLLFPAFRLFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAF 194
            :..:.:|:||                      |.:||||||.||:.:.:.::..||:.||:|:..
Zfish    53 YGASLLCNLI----------------------GFIYPAYASIKAIESNNKEDDTKWLTYWVVYGL 95

  Fly   195 FTCIETFTDIFISWLPFYYEVKVALVFWLLSPAT-KGSSTLYRKFVHPMLTRHEQEIDEYVNQAK 258
            |:..|.|:|||:.|.||||..|...:.|.::|.: .||..:|.:.|.|...:||...|..|:...
Zfish    96 FSVAEFFSDIFLFWFPFYYAGKCLFLLWCMAPISWNGSQVIYTRVVRPFFLKHEAAFDNVVSDLS 160

  Fly   259 ERGYSAVLQLGSKGV 273
            .:..||...:..:|:
Zfish   161 GKAKSAAETMAKEGL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 32/83 (39%)
zgc:101744NP_001013554.2 TB2_DP1_HVA22 55..143 CDD:281172 35/109 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.