DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and reep5

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001011272.1 Gene:reep5 / 496723 XenbaseID:XB-GENE-944534 Length:189 Species:Xenopus tropicalis


Alignment Length:172 Identity:48/172 - (27%)
Similarity:82/172 - (47%) Gaps:35/172 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LSFNTACICSLIVIFLAPRTCAQSLLFPAFRLFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVF 192
            :.:..:.:|:||                      |..||||.|.||:.:....:..:|:.||:|:
 Frog    51 IGYGASLLCNLI----------------------GFAYPAYVSIKAIESATKDDDTQWLTYWVVY 93

  Fly   193 AFFTCIETFTDIFISWLPFYYEVKVALVFWLLSPA-TKGSSTLYRKFVHPMLTRHEQEIDEYVNQ 256
            ..|:.||.|.|||:||.||||.:|...:.|.:||: :.|::.:|::.|.|...:||.|:|..|..
 Frog    94 GIFSIIEFFADIFLSWFPFYYMIKCGFLLWCMSPSPSNGATLIYKRIVRPFFLKHEGEMDRLVKD 158

  Fly   257 AKERGYSAVLQLGSKGVNYATNVLMQTAIKGGGNLVQTIKRS 298
            .|::            .:...:.:.:.|.|...||:...|:|
 Frog   159 IKDK------------ASETADTITKEAKKATVNLLGDEKKS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 32/83 (39%)
reep5NP_001011272.1 TB2_DP1_HVA22 67..144 CDD:367349 30/76 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.