DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and ReepB

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001188928.1 Gene:ReepB / 36569 FlyBaseID:FBgn0033906 Length:178 Species:Drosophila melanogaster


Alignment Length:118 Identity:40/118 - (33%)
Similarity:66/118 - (55%) Gaps:5/118 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 CAQSLLFP-AFRLFC---GTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDIFISW 208
            ||..|:|. ..:|.|   |.|||||.|..|:.:...::..||::||:.|..||.||.|:.:..|.
  Fly    53 CAIYLIFGWGAQLLCNIIGVLYPAYISIHAIESSTKQDDTKWLIYWVTFGIFTVIEFFSSLLTSV 117

  Fly   209 LPFYYEVKVALVFWLLSPATK-GSSTLYRKFVHPMLTRHEQEIDEYVNQAKER 260
            :|||:.:|.|.:.|.:.|..: ||:.:|.|.|.|...:|.:.:|..::...::
  Fly   118 IPFYWLLKCAFLIWCMLPTEQNGSTIIYNKLVRPYFLKHHESVDRIIDDGMKK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 33/86 (38%)
ReepBNP_001188928.1 TB2_DP1_HVA22 63..151 CDD:281172 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.