DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and Reep5

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001102358.2 Gene:Reep5 / 364838 RGDID:1306047 Length:189 Species:Rattus norvegicus


Alignment Length:157 Identity:49/157 - (31%)
Similarity:83/157 - (52%) Gaps:14/157 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SFNTACICSLIVIFLAPRTCAQSLLFPAFRLFCGTL---YPAYASYKAVRTKDVKEYVKWMMYWI 190
            ||....:..|:.::|.....|.        |.|..:   ||||.|.||:.:.:..:..:|:.||:
  Rat    35 SFIALGVIGLVALYLVFGYGAS--------LLCNLIGFGYPAYISMKAIESPNKDDDTQWLTYWV 91

  Fly   191 VFAFFTCIETFTDIFISWLPFYYEVKVALVFWLLSPA-TKGSSTLYRKFVHPMLTRHEQEIDEYV 254
            |:..|:..|.|:|:|:||.||||.:|...:.|.::|: :.|:..|||:.:.|:..:||.::|..|
  Rat    92 VYGVFSIAEFFSDLFLSWFPFYYMLKCGFLLWCMAPSPSNGAELLYRRVIRPIFLKHESQVDSVV 156

  Fly   255 NQAKERGYSAVLQLGSKGVNYAT-NVL 280
            ...|::.......: ||.|..|| |:|
  Rat   157 KDVKDKAKETADAI-SKEVKKATVNLL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 31/86 (36%)
Reep5NP_001102358.2 TB2_DP1_HVA22 55..143 CDD:281172 32/95 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.