DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and Reep1

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:XP_038963735.1 Gene:Reep1 / 362384 RGDID:1305230 Length:310 Species:Rattus norvegicus


Alignment Length:219 Identity:97/219 - (44%)
Similarity:121/219 - (55%) Gaps:46/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 FRLFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYYEVKVALVF 221
            :||..|||||||.|||||::||:|||||||||||:||.||..|||||||:.|.|||||:|:|.|.
  Rat    19 YRLIFGTLYPAYYSYKAVKSKDIKEYVKWMMYWIIFALFTTAETFTDIFLCWFPFYYELKIAFVA 83

  Fly   222 WLLSPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIK 286
            |||||.|||||.||||||||.|:..|:|||:.:.|||:|.|.|::..|.:|:|.|....:..|.|
  Rat    84 WLLSPYTKGSSLLYRKFVHPTLSSKEKEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASK 148

  Fly   287 -----------------GGGNLVQTIKRSYSLSDLSEPDMHRTQDELDDVMMSSMTSSAVVMRST 334
                             |.|.|.:.: ||:|:.||                            :|
  Rat   149 VARIFHFVSSLDLREGQGQGALSERL-RSFSMQDL----------------------------TT 184

  Fly   335 ATGARLLRPRNQTPVGRSGSGTRH 358
            ..|.....|....|.|...|..:|
  Rat   185 IRGDGAPAPSGPPPPGSGRSSGKH 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 63/82 (77%)
Reep1XP_038963735.1 TB2_DP1_HVA22 28..103 CDD:397309 57/74 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 136 1.000 Domainoid score I4803
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - otm44450
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X586
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.