DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and Reepl1

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_572730.1 Gene:Reepl1 / 32103 FlyBaseID:FBgn0030313 Length:240 Species:Drosophila melanogaster


Alignment Length:190 Identity:48/190 - (25%)
Similarity:84/190 - (44%) Gaps:32/190 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LFCGTLYPAYASYKAVRTKD--VKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYYEVKVALVF 221
            |..|..|||:||||.:::::  |.:...|::|||.:..:...:.||...::::|...|.||.|:|
  Fly    12 LLVGCFYPAFASYKILKSQNCSVNDLRGWLIYWIAYGVYVAFDYFTAGLLAFIPLLSEFKVLLLF 76

  Fly   222 WLLSPATKGSSTLYRKFVH---------PMLTRHEQEIDEYVNQ-----------AKER-----G 261
            |:|.....||..:|.:|:.         .:|.|...|..|.|.|           ..:|     |
  Fly    77 WMLPSVGGGSEVIYEEFLRSFSCNESFDQVLGRITLEWGELVWQQVCSVLSHLMVLADRYLLPSG 141

  Fly   262 YSAVLQLGSKGVNYATNVLMQTAI----KGGGNLVQTIKRSYSLS-DLSEPDMHRTQDEL 316
            :...||:.....:...:.:.:..:    |..|||..||......: ||:...:|.::.:|
  Fly   142 HRPALQITPSIEDLVNDAIAKRQLEEKRKQMGNLSDTINEVLGENIDLNMDLLHGSESDL 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 28/92 (30%)
Reepl1NP_572730.1 TB2_DP1_HVA22 8..95 CDD:281172 28/82 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12300
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.