DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and Reep3

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:XP_038954514.1 Gene:Reep3 / 294375 RGDID:1560401 Length:410 Species:Rattus norvegicus


Alignment Length:247 Identity:100/247 - (40%)
Similarity:137/247 - (55%) Gaps:22/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 RLFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYYEVKVALVFW 222
            ||..|.|||||.|||||:||:|||||:|||||||||.:|.|||..|..::|.|.|||:|:|.|.|
  Rat   167 RLVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLAWFPLYYELKIAFVIW 231

  Fly   223 LLSPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKG 287
            ||||.|:|:|.:||||:||:|:..|:|||:|:.|||||||..::..|.:|:|.|....:..|:|.
  Rat   232 LLSPYTRGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAAAAAVTAAVKS 296

  Fly   288 GGNLVQTIKRSYSLSDLS-----EPDMHRTQDELDDVMMSSMTSSAVVMRSTATGARLLRPRNQT 347
            .|.:.:.: ||:|:.||:     ||..||....|.:.......::    .|.|.|..|.....||
  Rat   297 QGAITERL-RSFSMHDLTAIQGDEPVGHRPYQTLPEAKRKGKQAT----ESPAYGIPLKDGSEQT 356

  Fly   348 PVGRSG----------SGTRHSTGMYFTEVDVTAKNA--GDFNYNIRSQDDI 387
            .....|          .|.|.|..|...:.....|..  |...|.::.:..:
  Rat   357 DEEAEGPFSDDEMVTHKGLRRSQSMKSVKTIKGRKEVRYGSLKYKVKKRPQV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 54/82 (66%)
Reep3XP_038954514.1 TB2_DP1_HVA22 175..251 CDD:397309 50/75 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - otm44450
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X586
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.