DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and Reep3

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001191844.1 Gene:Reep3 / 28193 MGIID:88930 Length:267 Species:Mus musculus


Alignment Length:279 Identity:103/279 - (36%)
Similarity:147/279 - (52%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYYEVKVALVFWL 223
            |..|.|||||.|||||:||:|||||:|||||||||.:|.|||..|..::|.|.|||:|:|.|.||
Mouse    12 LVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLAWFPLYYELKIAFVIWL 76

  Fly   224 LSPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKGG 288
            |||.|:|:|.:||||:||:|:..|:|||:|:.|||||||..::..|.:|:|.|....:..|:|..
Mouse    77 LSPYTRGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAAAAAVTAAVKSQ 141

  Fly   289 GNLVQTIKRSYSLSDLS-----EPDMHRTQDELDDVMMSSMTSSAVVMRSTATGARLLRPRNQTP 348
            |.:.:.: ||:|:.||:     ||..||....|.:.......::    .|.|.|..|.....|| 
Mouse   142 GAITERL-RSFSMHDLTAIQGDEPVGHRPYQTLPEAKRKGKQAT----ESPAYGIPLKDGSEQT- 200

  Fly   349 VGRSGSGTRHSTGMYFTEVDVTAKNAGDFNYNIRSQDDISSG-YSSAEPVS--GLSRTSSMTNAS 410
                                                |:.:.| :|..|.|:  .|.|:.||.:..
Mouse   201 ------------------------------------DEEAEGPFSDDEMVTHKALRRSQSMKSVK 229

  Fly   411 --KARAKSKRNELLEEMRD 427
              |.|.:....:.::.|::
Mouse   230 TIKGRKEELNKDPMQAMQE 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 53/81 (65%)
Reep3NP_001191844.1 TB2_DP1_HVA22 7..94 CDD:281172 53/81 (65%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..232 20/110 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - otm42387
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X586
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.