DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and SPBC30D10.09c

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_596276.1 Gene:SPBC30D10.09c / 2540280 PomBaseID:SPBC30D10.09c Length:217 Species:Schizosaccharomyces pombe


Alignment Length:187 Identity:46/187 - (24%)
Similarity:80/187 - (42%) Gaps:43/187 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DRVPLANAPTPKVVQNLNALGRMLELL----QRCPLPCLSFNTACICSLIVIFLAPRTCAQSLLF 154
            :::.||::.....|.....|..::.||    ||                  ||:|..: ::|...
pombe     7 EQISLASSVVATTVLVAPVLSTIINLLTNFGQR------------------IFIAADS-SKSTSM 52

  Fly   155 PAFRLFCGTLYPAYASY--------------KA--VRTKDVK----EYVKWMMYWIVFAFFTCIE 199
            .......|..||.|.:|              ||  :|.::.|    |..:.|.||.|:...|..|
pombe    53 EFLSTIIGAGYPIYKTYLLLELPSKRSQLLPKAFQLRNEEHKSIEEERRRLMAYWCVYGCVTAAE 117

  Fly   200 TFTDIFISWLPFYYEVKVALVFWLLSPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQ 256
            :....|:||:|||...|:....|||:|.|:|::.:|..::.|.|:.|:..|:.::.:
pombe   118 SILGRFLSWVPFYSTSKIVFWLWLLNPRTQGAAFIYASYISPFLSDHKAAINNFLEK 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 30/102 (29%)
SPBC30D10.09cNP_596276.1 TB2_DP1_HVA22 2..208 CDD:303060 46/187 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I3149
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - oto100458
orthoMCL 1 0.900 - - OOG6_102704
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2950
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.