DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and yop1

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_588478.1 Gene:yop1 / 2539171 PomBaseID:SPCC830.08c Length:182 Species:Schizosaccharomyces pombe


Alignment Length:157 Identity:40/157 - (25%)
Similarity:72/157 - (45%) Gaps:9/157 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 KVVQNLNALGRMLELLQRCPLPCLSFNTACICSLIVIFLAPRTCAQSLLFPAFRLFCGT-----L 164
            :|.||:..|...|....:  |..|..|..  .|.:.:||.........||..:..|..|     .
pombe     6 RVKQNMQDLDNRLAAFPQ--LNSLEKNFG--VSKLYVFLTAAGIYALFLFLNWGGFLLTNLLAFA 66

  Fly   165 YPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYYEVKVALVFWLLSPATK 229
            .||:.|..|:.|.:..:..:|:.|::|.:|...||.::.:.:.::|.|:.:|...:.||..|...
pombe    67 MPAFFSINAIETTNKADDTQWLTYYLVTSFLNVIEYWSQLILYYVPVYWLLKAIFLIWLALPKFN 131

  Fly   230 GSSTLYRKFVHPMLTRHEQEIDEYVNQ 256
            |::.:||..:.|.:|.|...|.:.|::
pombe   132 GATIIYRHLIRPYITPHVIRICKSVSR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 22/87 (25%)
yop1NP_588478.1 YOP1 3..182 CDD:227385 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.