DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and CG30177

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_726366.1 Gene:CG30177 / 246500 FlyBaseID:FBgn0050177 Length:206 Species:Drosophila melanogaster


Alignment Length:200 Identity:40/200 - (20%)
Similarity:78/200 - (39%) Gaps:45/200 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LFCGTLYPAYASYKAVRTKDVKEYVK-WMMYWIVFAFFTCIETFTDIFISWLPFYYEVKVALV-- 220
            ::.|||.|.::|.:|: ..|.:.::: |:.||:::|....:...||..:..|.||..:|:.|.  
  Fly     7 IYYGTLLPGWSSLRAI-GHDQRHFIELWLKYWVIYALLQGLGVLTDFLLGGLSFYAGLKLILSVG 70

  Fly   221 FWLLSPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAI 285
            .|               |..|..|.|      ..|.........:..:..|||.:...|      
  Fly    71 LW---------------FSAPYSTNH------LFNLLNTYSMGKLCPVVEKGVRWHEKV------ 108

  Fly   286 KGGGNLVQTIKRSYSLSDL------SEPDMHRTQDELDDVMMSSMTSSAVVMRSTATGARLLRPR 344
                  .:.|.|.:..|.|      .:.|.|.|:..:::.::....|:  :|...|..:...|.:
  Fly   109 ------CRNIFRGFMKSPLVTVVMPRDEDEHITEPRINNRLLKRELSN--LMTQIAKNSADHRHQ 165

  Fly   345 NQTPV 349
            :::|:
  Fly   166 HESPM 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 20/84 (24%)
CG30177NP_726366.1 TB2_DP1_HVA22 3..73 CDD:281172 19/81 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.