DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ReepA and REEP3

DIOPT Version :9

Sequence 1:NP_001188988.1 Gene:ReepA / 37643 FlyBaseID:FBgn0261564 Length:716 Species:Drosophila melanogaster
Sequence 2:NP_001001330.1 Gene:REEP3 / 221035 HGNCID:23711 Length:255 Species:Homo sapiens


Alignment Length:286 Identity:105/286 - (36%)
Similarity:152/286 - (53%) Gaps:49/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 LFCGTLYPAYASYKAVRTKDVKEYVKWMMYWIVFAFFTCIETFTDIFISWLPFYYEVKVALVFWL 223
            |..|.|||||.|||||:||:|||||:|||||||||.:|.|||..|..::|.|.|||:|:|.|.||
Human    12 LVFGMLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTVAWFPLYYELKIAFVIWL 76

  Fly   224 LSPATKGSSTLYRKFVHPMLTRHEQEIDEYVNQAKERGYSAVLQLGSKGVNYATNVLMQTAIKGG 288
            |||.|||:|.:||||:||:|:..|:|||:|:.|||||||..::..|.:|:|.|....:..|:|..
Human    77 LSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAATAAVTAAVKSQ 141

  Fly   289 GNLVQTIKRSYSLSDLS-----EPDMHRTQDELDDVMMSSMTSSAVVMRSTATGARLLRPRNQTP 348
            |.:.:.: ||:|:.||:     ||...|....|.:....|                  :|   .|
Human   142 GAITERL-RSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKS------------------KP---AP 184

  Fly   349 VGRSGSGTRHSTGMYFTEVDVTAKNAGDFNYNIRSQDDISSGYSSAEPVS--GLSRTSSMTNASK 411
            ...:|.|             :..|:..:     ::.::....||..|.::  ||.|:.||  .|.
Human   185 SESAGYG-------------IPLKDGDE-----KTDEEAEGPYSDNEMLTHKGLRRSQSM--KSV 229

  Fly   412 ARAKSKRNELLEEMRDEVYLDNQLYF 437
            ...|.::......::.:|....|:||
Human   230 KTTKGRKEVRYGSLKYKVKKRPQVYF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReepANP_001188988.1 TB2_DP1_HVA22 158..241 CDD:281172 54/81 (67%)
REEP3NP_001001330.1 TB2_DP1_HVA22 19..95 CDD:308643 51/75 (68%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 158..242 20/124 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1473891at2759
OrthoFinder 1 1.000 - - FOG0000584
OrthoInspector 1 1.000 - - otm40322
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X586
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.