DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nahoda and dao-2

DIOPT Version :10

Sequence 1:NP_523815.2 Gene:nahoda / 37641 FlyBaseID:FBgn0034797 Length:1335 Species:Drosophila melanogaster
Sequence 2:NP_872073.1 Gene:dao-2 / 173793 WormBaseID:WBGene00000928 Length:136 Species:Caenorhabditis elegans


Alignment Length:133 Identity:29/133 - (21%)
Similarity:42/133 - (31%) Gaps:52/133 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DFECYN--CTLRLLRQA----------DEWTTSYRFWSCADVDIKLRKDFKETCSGNG------K 179
            |.||.:  |....|.||          :...|....|.||    .||.:.::.|...|      |
 Worm    34 DKECVDRFCDFNALSQANILNFMSTCGERGPTVGEMWDCA----SLRHNHEDCCKKAGVSGECLK 94

  Fly   180 YFPSRCKCDKNFYGPQCQYKDE--CSADSDCGVQGKCVELGGTSLPKKQCYCNFGWFGIGCNKRS 242
            |    |...|   |....|.|.  |:.:.:        |:       :.|:.|.      .:|..
 Worm    95 Y----CTAHK---GAPSNYLDYAFCTENFN--------EI-------RDCFYNH------LDKNE 131

  Fly   243 PYK 245
            |:|
 Worm   132 PFK 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nahodaNP_523815.2 LPMO_10 <52..162 CDD:460793 11/40 (28%)
EGF_2 207..238 CDD:400365 3/30 (10%)
DOMON_like 255..>297 CDD:472705
DOMON_DOH <593..693 CDD:187689
DoH 766..918 CDD:214768
dao-2NP_872073.1 DB 26..123 CDD:460293 24/114 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.