DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nahoda and LOC1274876

DIOPT Version :10

Sequence 1:NP_523815.2 Gene:nahoda / 37641 FlyBaseID:FBgn0034797 Length:1335 Species:Drosophila melanogaster
Sequence 2:XP_314065.3 Gene:LOC1274876 / 1274876 VectorBaseID:AGAMI1_014427 Length:231 Species:Anopheles gambiae


Alignment Length:50 Identity:11/50 - (22%)
Similarity:18/50 - (36%) Gaps:20/50 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RHSPFAWTAR------------ALLLLATW--------CCYLGYLGSEAH 36
            |:....||.|            .:.::|:|        |.::...|.|||
Mosquito    46 RYFKTTWTTRRYFGVPVWNFYHRIYMIASWILTCAAIVCIFVDVRGFEAH 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nahodaNP_523815.2 LPMO_10 <52..162 CDD:460793
EGF_2 207..238 CDD:400365
DOMON_like 255..>297 CDD:472705
DOMON_DOH <593..693 CDD:187689
DoH 766..918 CDD:214768
LOC1274876XP_314065.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.