DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TMPRSS5

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_110397.2 Gene:TMPRSS5 / 80975 HGNCID:14908 Length:457 Species:Homo sapiens


Alignment Length:274 Identity:80/274 - (29%)
Similarity:122/274 - (44%) Gaps:46/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SACQSTPF---IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETD 155
            |.|.:.|.   ||||...:...:|:.|.:..        .....|||||:.|::|:|||||:.: 
Human   207 SECGARPLASRIVGGQSVAPGRWPWQASVAL--------GFRHTCGGSVLAPRWVVTAAHCMHS- 262

  Fly   156 ESKAERLDPNFDSPKFVVRLGELDYNSTT--DDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIAL 218
             .:..||.      .:.|..|.:.:::..  ..|||:     ..:.||.|..::.:.    |:||
Human   263 -FRLARLS------SWRVHAGLVSHSAVRPHQGALVE-----RIIPHPLYSAQNHDY----DVAL 311

  Fly   219 VELDRKAEFNDHVAAVCLPPDSGN--DVQQVTAAGWGFT--ADGVKSSHLLKVNLQRFSDEVCQK 279
            :.|.....|:|.|.|||||....:  ...:...:|||.|  :....|..|....:..||.::|..
Human   312 LRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYSSDMLQDTVVPLFSTQLCNS 376

  Fly   280 RLRFS-IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPC----LKQVIGIVSYGLVCGSQGL 339
            ...:| ..|....|||.:..:||.|.||||||:.       |    ..:::|:||:|..|.....
Human   377 SCVYSGALTPRMLCAGYLDGRADACQGDSGGPLV-------CPDGDTWRLVGVVSWGRGCAEPNH 434

  Fly   340 PSVYTKVHLYTDWI 353
            |.||.||..:.|||
Human   435 PGVYAKVAEFLDWI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/263 (29%)
Tryp_SPc 102..353 CDD:214473 75/261 (29%)
TMPRSS5NP_110397.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
SRCR_2 116..213 CDD:292133 2/5 (40%)
Tryp_SPc 217..448 CDD:214473 75/262 (29%)
Tryp_SPc 218..451 CDD:238113 77/263 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.