DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Cfi

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_077071.1 Gene:Cfi / 79126 RGDID:620429 Length:604 Species:Rattus norvegicus


Alignment Length:273 Identity:81/273 - (29%)
Similarity:110/273 - (40%) Gaps:57/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNF 166
            :|||..|...::|:...|        |......|||..:...::||||||:.....:        
  Rat   362 VVGGKPAEMGDYPWQVAI--------KDGDRITCGGIYIGGCWILTAAHCVRPSRYR-------- 410

  Fly   167 DSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVEL-----DRKAE 226
               .:.|....||:........||.  |...|||..|:...    ::|||||||:     .::.|
  Rat   411 ---NYQVWTSLLDWLKPNSQLAVQG--VSRVVVHEKYNGAT----YQNDIALVEMKKHPGKKECE 466

  Fly   227 FNDHVAAVCLP--PDSGNDVQQVTAAGWGFTADGVKSSHL------LKVNLQRF-SDEVCQKRLR 282
            ..:.|.| |:|  |.......:...:|||...|..|...|      |..|..|| .....:|.::
  Rat   467 LINSVPA-CVPWSPYLFQPNDRCIISGWGREKDNQKVYSLRWGEVDLIGNCSRFYPGRYYEKEMQ 530

  Fly   283 FSIDTRTQFCAGSMSSQADTCNGDSGGPIF---VQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYT 344
                     |||:.....|.|.||||||:.   |.:..|     |.||||:|..||....|.|||
  Rat   531 ---------CAGTSDGSIDACKGDSGGPLVCKDVNNVTY-----VWGIVSWGENCGKPEFPGVYT 581

  Fly   345 KVHLYTDWIESIV 357
            :|..|.|||...|
  Rat   582 RVASYFDWISYYV 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/270 (30%)
Tryp_SPc 102..353 CDD:214473 78/267 (29%)
CfiNP_077071.1 FIMAC 46..111 CDD:214493
SR 117..220 CDD:214555
SRCR 122..219 CDD:278931
LDLa 228..258 CDD:197566
LDLa 264..298 CDD:294076
Tryp_SPc 361..590 CDD:214473 78/267 (29%)
Tryp_SPc 362..591 CDD:238113 79/268 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.