DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and f7

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001072819.1 Gene:f7 / 780280 XenbaseID:XB-GENE-5787186 Length:452 Species:Xenopus tropicalis


Alignment Length:369 Identity:107/369 - (28%)
Similarity:159/369 - (43%) Gaps:79/369 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CDNGTGECKELTPS---DCPVIFYNQHLIGAEVKYCD-EFNDIVCCPIP------LDHQNLKPAE 77
            |.|| |.|.:...|   .||        :|.|.::|: ...|::.|...      ..|.|...:.
 Frog   117 CMNG-GTCFDQHQSYICTCP--------MGYEGRHCETNLRDMLKCIYDNGQCEHFCHDNSSTSR 172

  Fly    78 QTRPFE--------KQCKQYNEVRSACQSTPF---------IVGGTKASGKEFPFMALIGTHRPN 125
            |....|        ..|:.  .|...|...|.         ||||......|.|:.||:      
 Frog   173 QCSCAEGYKLGADGLSCEP--TVNYPCGKIPVLKNVNKRARIVGGDMCPKGECPWQALL------ 229

  Fly   126 KSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQ 190
             ..::| :.|||:::.|.:|:||||||:.       |..|    |..|.|||  :...|.:...|
 Frog   230 -MYNEI-FICGGTLIAPNWVITAAHCLKP-------LPEN----KLTVVLGE--HRIGTPEGTEQ 279

  Fly   191 DFRVVNYVVHPGY---DTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQV----- 247
            :.:|...::|..|   .|.::     |||||::|.....:.|:|..:|| |:....||::     
 Frog   280 ESKVSKIIMHEHYYGSKTNND-----NDIALLKLTTPVNYTDYVVPLCL-PEKQFAVQELLSIRY 338

  Fly   248 -TAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGP 310
             |.:||| ....|.....|.:|.|.|...:.|.::.:.:| ::..||||......|:|.||||||
 Frog   339 STVSGWGRLLESGATPELLQRVQLPRVKTQDCIRQTQMNI-SQNMFCAGYTDGSKDSCKGDSGGP 402

  Fly   311 IFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            ...|   |.....:.||||:||.|..:....|||:|..||:||:
 Frog   403 HATQ---YKNTHFLTGIVSWGLGCAKKEKYGVYTRVSRYTEWIK 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 86/263 (33%)
Tryp_SPc 102..353 CDD:214473 84/260 (32%)
f7NP_001072819.1 Gla 67..107 CDD:366184
EGF_CA 108..144 CDD:238011 10/35 (29%)
FXa_inhibition 153..189 CDD:373209 5/35 (14%)
Tryp_SPc 212..445 CDD:238113 86/263 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.