DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and zgc:153968

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:281 Identity:83/281 - (29%)
Similarity:122/281 - (43%) Gaps:55/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SACQ--------STPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAH 150
            |.||        ..|.|:||..|....:|:...| .:.|.....     |||::::.::||:||.
Zfish    20 SLCQLDVCGRAPLKPRIIGGQTAMAGSWPWQVSI-HYIPTGGLL-----CGGTLINREWVLSAAQ 78

  Fly   151 CLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQD--FRVVNYVVHPGYDTEDEEQGFK 213
            |.:           ...:...||.||.|   ||.|..::.:  .:::|   ||.||:...    |
Zfish    79 CFQ-----------KLTASNLVVHLGHL---STGDPNVIHNPASQIIN---HPKYDSATN----K 122

  Fly   214 NDIALVELDRKAEFNDHVAAVCLPPDSGND-----VQQVTAAGWGFTADGVKS--SHLLKVNLQR 271
            |||||::|.....|.|::..|||.. ||:.     |..:|  |||....|...  :.|.:|.:..
Zfish   123 NDIALLKLSTPVSFTDYIKPVCLTA-SGSSLGKGAVSWIT--GWGSINTGGTQFPTTLQEVKIPV 184

  Fly   272 FSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVI--GIVSYGLVC 334
            .|:..| |....|:.|....|||........|.||.|||:     ::...:|.|  ||.|:|..|
Zfish   185 VSNGDC-KSAYGSLITDGMICAGPNEGGKGICMGDGGGPL-----VHNSSEQWIQSGIASFGRGC 243

  Fly   335 GSQGLPSVYTKVHLYTDWIES 355
            .....|.|:|:|..|..||:|
Zfish   244 AQPKNPGVFTRVSEYESWIKS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/265 (30%)
Tryp_SPc 102..353 CDD:214473 76/261 (29%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 76/262 (29%)
Tryp_SPc 36..265 CDD:238113 79/265 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.