DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and TPSAB1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:278 Identity:81/278 - (29%)
Similarity:118/278 - (42%) Gaps:59/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINW--DCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            ||||.:|...::|:...:..|.|       .|  .||||::||::|||||||:..|......|  
Human    31 IVGGQEAPRSKWPWQVSLRVHGP-------YWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAAL-- 86

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
                 :..:|...|.|    .|.|:...|:   :|||.:.|..    ...||||:||:.....:.
Human    87 -----RVQLREQHLYY----QDQLLPVSRI---IVHPQFYTAQ----IGADIALLELEEPVNVSS 135

  Fly   230 HVAAVCLPPDSGN--DVQQVTAAGWGFTADGVK---SSHLLKVNLQRFSDEVCQKRLRFSI---- 285
            ||..|.|||.|..  ........|||...:..:   ...|.:|.:....:.:|..:.....    
Human   136 HVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGD 200

  Fly   286 DTR----TQFCAGSMSSQADTCNGDSGGPI-------FVQHPLYPCLKQVIGIVSYGLVCGSQGL 339
            |.|    ...|||  :::.|:|.||||||:       ::|          .|:||:|..|.....
Human   201 DVRIVRDDMLCAG--NTRRDSCQGDSGGPLVCKVNGTWLQ----------AGVVSWGEGCAQPNR 253

  Fly   340 PSVYTKVHLYTDWIESIV 357
            |.:||:|..|.|||...|
Human   254 PGIYTRVTYYLDWIHHYV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/275 (29%)
Tryp_SPc 102..353 CDD:214473 78/272 (29%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 79/273 (29%)
Tryp_SPc 31..267 CDD:214473 78/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.